PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy014534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 547aa    MW: 61653.8 Da    PI: 5.9224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59553171PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.21.4e-1271765461373
       GRAS   1 lvelLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                l+++L++cA+avs++d + a   + + l +++s +g+p+qRl ay++e+L+arl +s+s +yk+l++++ +   s+e +++++++++++P+ kf++++aN
  Ahy014534 176 LRDVLVRCAQAVSDDDIATAIGWMDNvLGKMVSVYGEPLQRLGAYLLEGLRARLESSGSMIYKSLKCEQPT---SKELMSYMHILYQICPFWKFAYVAAN 272
                5789**************9988886527899***************************************9...99999********************* PP

       GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  Ilea+++e+++Hi+Df+i+qG+QW+ L+qaLa Rp+gpps+RiT+v++++s   +   le +g+rL++fA+++gvp+ef++ +a   +++e  ++ ++
  Ahy014534 273 AVILEAMATESMIHILDFQITQGTQWLLLIQALAHRPGGPPSIRITAVDDSQSIhaRGGGLEIVGQRLSDFARSCGVPLEFHI-AAMCGSQVERTNIVIR 371
                **************************************************9988889999**********************9.899************* PP

       GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 gEalaVn+ + lh++ desvs+e++rd++L+lvkslsPkvv++veqe+++n++sF++rf+e ++yy+a+f+s++a+ pr++++r + E+++++r+ivn+
  Ahy014534 372 AGEALAVNFPYVLHHMQDESVSTENHRDRLLRLVKSLSPKVVTLVEQESNTNTSSFFNRFVEIMDYYTAMFESIDAGCPRDDRKRLNAEQHCVARDIVNM 471
                **************************************************************************************************** PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                vaceg er+erhe l+kWr+r+++aGF++ pls ++++ ++ +l++++++ yrve+++++l+lgW++r++v+ SaW
  Ahy014534 472 VACEGVERVERHELLGKWRMRFSMAGFRQWPLSPSVVAAVRNMLKEFNGN-YRVEQRDDALYLGWMRRAMVTSSAW 546
                ************************************************77.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.655150528IPR005202Transcription factor GRAS
PfamPF035145.0E-125176546IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MQISKRHPSQ AGIRFYHQPV QSMYQMLQSN LCHSIHHDNM MKGATVSFES CKDQYFTLES  60
SPATTELIGC ETDSPSYASG LSSNRSPFSP QVSQSCYSDN HHSSDNTYGS PYSSVDDGNE  120
WKHKLRELEI SLLEPNESDA ADSYDNNCVQ GGLTTASPTI EYDWDQIVQM IPKLELRDVL  180
VRCAQAVSDD DIATAIGWMD NVLGKMVSVY GEPLQRLGAY LLEGLRARLE SSGSMIYKSL  240
KCEQPTSKEL MSYMHILYQI CPFWKFAYVA ANAVILEAMA TESMIHILDF QITQGTQWLL  300
LIQALAHRPG GPPSIRITAV DDSQSIHARG GGLEIVGQRL SDFARSCGVP LEFHIAAMCG  360
SQVERTNIVI RAGEALAVNF PYVLHHMQDE SVSTENHRDR LLRLVKSLSP KVVTLVEQES  420
NTNTSSFFNR FVEIMDYYTA MFESIDAGCP RDDRKRLNAE QHCVARDIVN MVACEGVERV  480
ERHELLGKWR MRFSMAGFRQ WPLSPSVVAA VRNMLKEFNG NYRVEQRDDA LYLGWMRRAM  540
VTSSAWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-521805468374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015940649.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_015940643.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_015940638.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A151SU720.0A0A151SU72_CAJCA; Scarecrow-like transcription factor PAT1
STRINGGLYMA17G01150.10.0(Glycine max)